|
|
|
|||
| Home Help Feedback Subscriptions Archive Search Table of Contents | ||||
Laboratory of Developmental Signalling, Cancer Research UK London Research Institute, 44 Lincolns Inn Fields, London WC2A 3PX, UK
*Author for correspondence (e-mail: caroline.hill{at}cancer.org.uk)
Accepted 28 March 2002
| SUMMARY |
|---|
|
|
|---|
Key words: Fast, Forkhead/winged helix, Gastrulation, Smad, TGFß signalling, Xenopus
| INTRODUCTION |
|---|
|
|
|---|
The activin signal transduction pathway is well characterised, and the pathways activated by the related ligands are thought to be similar. Receptor activation leads to phosphorylation and activation of receptor-regulated Smads (Hill, 2001
). In early Xenopus embryos, this is primarily XSmad2 (Faure et al., 2000
), as there is little or no XSmad3 present at this time (Howell et al., 2001
). Activated XSmad2 forms a complex with a co-Smad, which in the blastula and early gastrula is XSmad4ß (Howell et al., 1999
). The XSmad2/XSmad4ß complexes accumulate in the nucleus and are recruited to distinct promoter elements by site-specific transcription factors. The paired-like homeodomain proteins Mixer, Milk and Bix3 can recruit active Smad complexes to the distal element (DE) of the goosecoid promoter (Germain et al., 2000
; Randall et al., 2002
), whereas the forkhead/winged-helix transcription factor XFast-1 recruits active Smad complexes to the activin responsive elements (AREs) in the Mix.2 promoter and Xnr1 enhancer (Chen et al., 1996
; Osada et al., 2000
). Although the DNA binding specificity of these transcription factors is very different, their interaction with the activated Smad complex occurs in all cases through a common short Smad interaction motif (SIM) (Germain et al., 2000
).
Two distinct XSmad2/XSmad4ß-containing complexes bind the Mix.2 ARE (Howell et al., 1999
). One, ARF1 (formally ARF for activin responsive factor) (Chen et al., 1996
) is activated in Xenopus embryos by overexpressing activin. It comprises XFast-1, XSmad2 and XSmad4ß, and is detected in nuclear extracts at approximately 80 minutes post stage 8 (Chen et al., 1996
; Howell et al., 1999
). The other is a distinct complex that we have named ARF2, and is distinguished from ARF1 by its faster mobility on a bandshift gel, its inducibility and time of appearance. It contains XSmad2 and XSmad4ß, is activated by endogenous signalling molecules and is readily detected in nuclear extracts from uninjected embryos at about 240 minutes post stage 8 (Howell et al., 1999
). ARF2 is the only ARF detected in uninjected embryos and perhaps, therefore, the most quantitatively important.
We have identified a novel Fast family member, XFast-3, which is expressed only during gastrulation, and is the transcription factor component of ARF2. XFast-3 contains a forkhead/winged-helix DNA binding domain and a high affinity SIM, through which it recruits activated Smad2 and Smad4 to the ARE more efficiently than XFast-1. We identify derrière as a good candidate for the endogenous signalling molecule that activates the XFast-3/Smad complex in vivo. Using highly specific morpholino antisense oligonucleotides (Heasman et al., 2000
; Nasevicius and Ekker, 2000
) to efficiently and specifically inhibit the synthesis of XFast-1 or XFast-3, and hence the formation of ARF1 and ARF2, we identify a major role for ARF1 and ARF2 in controlling the convergent extension movements of gastrulation.
| MATERIALS AND METHODS |
|---|
|
|
|---|
ZAPII using a probe comprising the coding region of XFast-1 (Chen et al., 1996
Embryo manipulations, in situ hybridisation and morpholino oligonucleotide injections
Fertilisation, culture, staging, microinjection of Xenopus embryos and animal cap assays were exactly as previously described (Howell and Hill, 1997
). Full-length synthetic mRNA for injection was prepared as described (Howell and Hill, 1997
) and the amounts of individual mRNAs injected are given in the legend to Figs 5 and 7. In vitro translations were performed as described (Howe et al., 1995
).
|
|
Morpholino oligonucleotides were obtained from Gene Tools LLC and had the base composition 5'AGTACAGACTGGAGGGGTCTCTCAT3' (anti-XFast-1); 5'GGTGAAGCCCAAAAGACATGTCAGT3' (anti-XFast-3) and 5'CCTCTTACCTCAGTTACAATTTATA3' (human ß-globin control). They were resuspended in sterile water at a concentration of 17 mg/ml (2 mM), centrifuged and injected into single cell embryos at a dose of 10-25 ng per embryo.
Tissue culture, transfections and transcription assays
NIH3T3 cells were cultured and transfected as described (Germain et al., 2000
). Transcription assays using the ARE-luciferase reporter were as described (Pierreux et al., 2000
).
Bandshift assays and western blotting
For bandshift assays, nuclear extracts from Xenopus embryos and transfected NIH3T3 cells were prepared as described (Howell et al., 1999
; Pierreux et al., 2000
) and whole cell NIH3T3 extracts were as described (Germain et al., 2000
). Bandshift assays and supershifts with antibodies against Smad4, Smad2/3 and Flag were as described (Howell et al., 1999
; Pierreux et al., 2000
). The anti-XFast-1 and anti-XFast-3 antibodies were polyclonal anti-peptide antibodies generated in rabbits against the following peptides (PVATGQSYNHSVQPWPQPWC, XFast-1 and FGLHPWDVAFRPSPPHNLEC, XFast-3). In supershift assays, antibodies were added either alone or with 5 µg of the peptide to which they were raised. All SIM peptides (Germain et al., 2000
) used in the competitions had the penetratin sequence (RQIKIWFQNRRMKWKK) at the N terminus, followed by the specific sequences PEVKNAPKDFPPNKTVFDIPVYTGHPGFLA (XFast-3 SIM wild type); PEVKNAPKDFAAAKTVFDIPVYTGHPGFLA (XFast-3 SIM mutant); PLDLNMLRAMPPNKSVFDVLTSHPGDLV (XFast-1 SIM wild type); and PLDLNMLRAMAAAKSVFDVLTSHPGDLV (XFast-1 SIM mutant). Peptides were dissolved in water and used at the amounts indicated in the legend to Fig. 3.
|
Isolation of total RNA and RNase protections
Isolation of total RNA from Xenopus embryos and RNase protections were as described (Howell et al., 1999
). The following antisense probes were as previously described: Mix.1/Mix.2 and goosecoid (Germain et al., 2000
), XFKH1 and chordin (Howell and Hill, 1997
), XWnt11 (Tada and Smith, 2000
), shh (Ekker et al., 1995
) and Xbra, EF-1
and FGFR (Howell et al., 1999
). Other antisense probes protected nucleotides encoding the following: XFast-1, amino acids 473-534; XFast-3, 274-323; XDelta1, 465-721; cerberus, 1-95; Xlim-1, 214-333; and paraxial protocadherin (PAPC) (Kim et al., 1998
) amino acids 966-979 and 578 nucleotides of the 3' UTR.
| RESULTS |
|---|
|
|
|---|
|
XFast-3 forms a transcriptionally active complex at the ARE with endogenous Smad2 and Smad4 in a ligand-dependent manner
Upon TGFß induction, transfected XFast-1 forms a XFast-1/Smad2/Smad4 complex (ARF1) with endogenous Smads in NIH3T3 cells (Fig. 2A, lanes 1,2) (Germain et al., 2000
)). Similarly, a TGFß-induced XFast-3/Smad2/Smad4 complex (ARF2) is detected in extracts from cells transfected with Flag-tagged XFast-3 (lanes 6,7). Supershifts with specific antibodies demonstrated that these ARF complexes contained the relevant Flag-tagged Fast transcription factor, Smad2 and Smad4 (lanes 3-5 and 8-10).
|
XFast-3 is the endogenous transcription factor component of ARF2
To prove that XFast-3 is the transcription factor component of the endogenous Xenopus ARF2 complex, we raised specific polyclonal anti-peptide antibodies against XFast-1 and XFast-3. Endogenous Xenopus ARF1, which is detected in extracts from embryos that overexpress activin 80 minutes after stage 8 (Fig. 2C, lane 7) is supershifted by the anti-XFast-1 antibody and not by the anti-XFast-3 antibody (lanes 9 and 11). By contrast, endogenous ARF2, which is readily detected in extracts from uninjected embryos 240 minutes post stage 8 (lane 13), is supershifted only by the anti-XFast-3 antibody (lanes 15 and 17). In both cases, the supershifts were reversed by the peptide to which the antibody had been raised (lanes 10 and 18). Thus, the endogenous ARF2, which is activated in response to endogenous signalling pathways, contains XFast-3, and ARF1, which is detectable only when activin is overexpressed, contains XFast-1 as previously demonstrated (Watanabe and Whitman, 1999
).
XFast-3 very efficiently competes with XFast-1 for binding to activated Smads and to the ARE
Even when activin is overexpressed in embryos, the XFast-1-containing ARF1 complex disappears at
240 minutes post stage 8, coincident with the appearance of the XFast-3-containing complex, ARF2 (Howell et al., 1999
), suggesting that either the XFast-1 protein is degraded at this time, or XFast-3 efficiently competes with XFast-1 for activated Smads and the ARE. We tested the latter idea by transfecting NIH3T3 cells with a constant amount of XFast-3 and a titration of XFast-1, or a constant amount of XFast-1 and a titration of XFast-3, checking the actual amount of each XFast expressed by western blotting.
When expressed at equimolar levels (Fig. 3A, lanes 4 or 12, lower panel) XFast-3 forms a complex with activated Smads and DNA much more readily than does XFast-1. Even when XFast-3 was expressed at barely detectable levels in the western blot, a strong ARF2 complex was detected (lane 3). Indeed ARF2 competes efficiently with ARF1 (e.g. compare lanes 2 and 5) while ARF1 competes very inefficiently with ARF2 (lanes 9-12). This was not explained by Fast-DNA binding affinity as XFast-1 bound DNA in the absence of Smads considerably more strongly than did XFast-3 (data not shown; note the readily detectable levels of XFast-1-DNA complexes in lanes 1-6 and absence of XFast-3/DNA complexes in lanes 7-12). We therefore investigated the relative strength of the Fast SIMs by a peptide competition assay in which SIM peptides disrupt transcription factor-Smad complexes by binding to the activated Smad2 component (Germain et al., 2000
). The XFast-3 SIM peptide disrupted the ARF1 complex at a much lower concentration than did the XFast-1 SIM peptide, indicating that the XFast-3 SIM has a much higher affinity for Smad2 than the XFast-1 SIM (Fig. 3B, lanes 3-6 and 11-14). Moreover, the XFast-3 SIM peptide, but not the XFast-1 SIM peptide disrupted the ARF2 complex (Fig. 3C, lanes 3-5 and 9-11). Controls with mutant peptides indicated that the peptides were specific (Fig. 3B,C). The strong interaction between XFast-3 and the Smads in ARF2 is also evident from the observation that
10-fold more XFast-3 SIM peptide was needed to disrupt ARF2 than ARF1 (compare Fig. 3B lane 6 with 3C lane 4).
Thus, when XFast-3 and XFast-1 are co-expressed, XFast-3 preferentially binds activated Smads and forms the ARF2 complex at the ARE.
XFast-3 has a narrow window of expression during early- and mid-gastrulation
In Xenopus embryos, XFast-3 mRNA is expressed only during gastrulation, coincident with the appearance of ARF2 (Fig. 4A; stage 10.25-11). This pattern contrasts with that of XFast-1, which is present as a maternal message, and is maintained zygotically until it finally disappears between stage 18 and 21 (Fig. 4A) (Chen et al., 1996
).
|
Complexes containing XFast-3 are preferentially activated by derrière and VegT
ARF2 forms in response to endogenous ligands (Fig. 1A) (Howell et al., 1999
). To identify possible candidates, we assayed whether Xnr1 or Xnr2 (Jones et al., 1995
), derrière (Sun et al., 1999
), activin itself or VegT, the T-box transcription factor that regulates a number of these activin-like ligands (Zhang et al., 1998
), could activate the formation of ARF2. BMP4, which does not activate Smad2, was used as a negative control. ARF1 is activated only at the early time point by overexpression of activin and Xnr1 and weakly by Xnr2 (Fig. 5A, top panel), while ARF2 is activated by endogenous signals at the later time point (bottom panel, lane 1) and by overexpression of derrière and VegT (lanes 5 and 11). All the inducers were active as demonstrated by their ability to induce mesoendodermal marker genes (data not shown).
As ARF complex formation requires Smad2 phosphorylation, we investigated the ability of the inducers to induce Smad2 phosphorylation at the two time points by western blotting (Faure et al., 2000
). At 80 minutes post stage 8, Xnr1 and activin, and to a lesser extent Xnr2, activated Smad2, whereas VegT, derrière and BMP4 did not (Fig. 5B, top panels). By stage 10.5, levels of phosphorylated Smad2 in uninjected embryos were elevated as a result of endogenous activin-like signalling pathways (bottom panels, lane 1). Overexpression of Xnr1, Xnr2, derrière and activin all efficiently induced the level of phosphorylated Smad2 at this stage (bottom panels).
Thus, although derrière mRNA was injected at the one-cell stage, it only activates Smad2 at stage 10.5 (Fig. 5B) (Lee et al., 2001
). Consequently derrière (and also VegT, which activates derrière) (Sun et al., 1999
), only activates ARF2, which contains the zygotic transcription factor XFast-3. By contrast, Xnr1, Xnr2 and activin all induce phosphorylation of Smad2 by 80 minutes post stage 8 and thus preferentially activate ARF1, which contains maternal XFast-1. Xnr1, Xnr2 and activin also activate Smad2 at the time at which ARF2 appears, but do not induce its formation. This is because they downregulate XFast-3 mRNA, and presumably also XFast-3 protein (Fig. 5C).
Thus, ARF1 and ARF2 are preferentially activated by distinct signalling molecules, and the data indicate that derrière is a good candidate for the endogenous activator of ARF2.
Morpholino oligonucleotides directed against XFast-1 or XFast-3 specifically knockdown levels of these molecules in the developing embryo
To determine the role of these two ARF complexes in early Xenopus embryos, we used specific morpholino (MO) antisense oligonucleotides (Heasman et al., 2000
; Nasevicius and Ekker, 2000
; Summerton and Weller, 1997
; Winklbauer et al., 2001
) to knockdown levels of their constituent transcription factors, XFast-1 or XFast-3. In all experiments, a human ß-globin MO was used to rule out any nonspecific effects of morpholinos per se (control-MO) and we ensured that the total MO concentration was constant for each manipulation.
Morpholinos designed against either XFast-1 or XFast-3 mRNA sequences specifically inhibited the in vitro translation of their respective cognate mRNAs but not vice versa (Fig. 6A, upper two panels, lanes 2, 3 and 4). N-terminally epitope-tagged versions of either XFast-1 and XFast-3 mRNAs, which cannot bind to their respective morpholinos, are resistant to translational inhibition (Fig. 6A, lower two panels).
|
When XFast-1 and XFast-3 MOs were injected together, the formation of both ARF1 and ARF2 was dramatically reduced (10-20 fold; lanes 16-19).
Thus, the morpholino oligonucleotides specifically and efficiently knockdown synthesis of XFast-1 and XFast-3 in vitro and in vivo and consequently reduce levels of endogenous ARF complexes 10- to 20-fold without nonspecific toxicity.
Phenotypic effects of ARF depletion
Depletion of either or both ARF complexes produced embryos exhibiting a range of overlapping phenotypes. At all developmental stages, ARF2 depletion alone produced the weakest phenotypes, as might be predicted if ARF1 can compensate for a loss of ARF2 (see Fig. 6B), whereas the effect of ARF1 depletion was more severe. Depletion of both gave an additive effect and the most severe phenotypes. A typical experiment is summarised in Table 1. Embryos injected with the control MO are phenotypically wild type.
|
The loss of axial structures upon depletion of ARF1, ARF2 or both is demonstrated by the pattern of sonic hedgehog (shh) staining. In control MO-injected embryos, shh is expressed along the notochord and floor plate. Levels of shh are very much reduced in embryos depleted of ARF1 and/or ARF2. Somites were formed in all cases as demonstrated by actin expression; however none of the embryos depleted of ARF1 and/or ARF2 could respond to mechanical stimuli (Table 1; data not shown).
Depletion of ARF1 and ARF2 has a severe effect on gastrulation movements
As the length of the embryonic axis is determined in part by the convergent extension movements of gastrulation, we analysed the effect of ARF depletion at these early developmental stages in more detail, initially investigating the expression of a panel of early mesoendodermal genes (Fig. 6D). In no case did we observe complete loss of induction of gene expression. When the embryos injected with control MO had reached stage 10, embryos injected with either XFast-1 or XFast-3 MOs or both showed reduced expression of Xlim-1, Xbra and XFKH1, while levels of Mix.1/Mix.2, XWnt11, chordin or the ubiquitously expressed EF-1
were unaffected and goosecoid expression was actually increased (Fig. 6D). Similarly, in activin-induced animal caps only relatively small effects of depletion of ARF1 and/or ARF2 were seen (Fig. 6E).
A more dramatic effect of ARF1/ARF2 depletion was on the spatial pattern of expression of these mesoendodermal genes, which indicated that gastrulation movements were impaired (Fig. 6F). Control MO-injected embryos gastrulate normally, closing the blastopore and extending along the dorsal midline as a result of the convergent extension movements. Xbra and XFKH1 are expressed on the extended dorsal midline (and in the case of Xbra, in the circumblastoporal mesoderm), XDelta1 is excluded from the dorsal midline, but expressed in patches in the neural plate (Fig. 6F, panels a,c,e,g,i) (Dirksen and Jamrich, 1992
; Henrique et al., 1995
; Ruiz i Altaba and Jessell, 1992
; Smith et al., 1991
). By contrast, embryos of the same age depleted of both ARF1 and ARF2 expressed Xbra and XDelta1 throughout the marginal zone although it is displaced towards the animal pole (Fig. 6F, panels b,f,h). In the ARF1/ARF2-depleted embryos, XFKH1 is dorsally expressed, but in a patch, as opposed to along the extended dorsal axis (Fig. 6F, compare panel c with d and i with j).
Midsagittal sections of control MO-injected embryos indicated that gastrulation has proceeded normally to form the archenteron (Fig. 6F, panels g,i), whereas in the ARF1/ARF2-depleted embryos the midsagittal sections suggested that no convergent extension movements had occurred and no archenteron had formed (Fig. 6F, panels h,j). Note that not all gastrulation movements are affected in the ARF-depleted embryos, as these embryos had undergone significant mesoendoderm migration (Fig. 6F, panels h,j, black arrows).
ARF1 and ARF2 are required for activin-induced convergent extension movements in animal cap explants
We tested directly whether depletion of ARF1 and ARF2 prevents the convergent extension movements of gastrulation. Animal caps cut at stage 8 from embryos injected with the control MO extended dramatically when treated with activin (Fig. 7A). By contrast, those injected with XFast-1 and XFast-3 MOs, and thus depleted of both ARF1 and ARF2, did not extend at all (Fig. 7A).
Extension of animal caps treated with activin at stage 8 is primarily dependent on XFast-1, as no XFast-3 is expressed at stage 8 (Fig. 4A). To prove that the effects of the morpholinos are specifically due to depletion of the XFasts, we confirmed that injection of the XFast-1-MO inhibited animal cap extension, but injection of the XFast-3-MO did not (Fig. 7B, panels a-d). Furthermore, the inhibition of activin-induced extension of XFast-1-depleted animal caps could be efficiently rescued by morpholino-resistant versions of XFast-1 or XFast-3 mRNA (Fig. 7B, panels e and f). This was specific, as control GFP mRNA could not rescue the phenotype (Fig. 7B, panel d). This further confirmed that the cap phenotype was due to the depletion of XFast-1 (and thus ARF1). As previously shown by Whitman and colleagues (Watanabe and Whitman, 1999
), overexpression of full length XFast-1 is deleterious to normal embryonic development, and thus it was not possible to rescue the whole embryo phenotypes.
Taken together with the embryo phenotypes, the data indicate that in whole embryos, ARF1 and ARF2 are required for the convergent extension movements of gastrulation.
| DISCUSSION |
|---|
|
|
|---|
From our morpholino experiments, it is clear that inhibiting the expression of XFast-3 produces an embryonic phenotype on its own, albeit a weaker phenotype than for XFast-1-depleted embryos. XFast-1 and XFast-3 are therefore not completely functionally redundant. It is also evident that XFast-1 compensates for the loss of XFast-3 better than XFast-3 compensates for the loss of XFast-1, probably as a result of their different temporal expression patterns.
The lack of redundancy suggests there may be a subset of XFast-3/ARF-specific target genes whose expression cannot be rescued by XFast-1/ARF1. Indeed, site selections with XFast-1 and XFast-3 have revealed subtle differences in site preference for both the transcription factors in isolation and for the ARF complexes containing them (M. H. and C. S. H., unpublished). Alternatively, as the phenotype of the XFast-3 knockdown embryos only differs from the phenotype of the XFast-1 knockdown embryos by degrees of severity, XFast-3 may be required for maximal expression of all or some of the XFast-1 target genes, in response to distinct signals or levels of signal. The stronger interaction of XFast-3 with activated Smads will enable cells expressing XFast-3 to respond to a wider range of ligand concentrations than cells expressing only XFast-1. Moreover ARF complexes containing these two transcription factors can be activated by different activin-related ligands: ARF1 is preferentially activated by Xnr1 and activin, ARF2 by derrière. In fact, high levels of Xnr1/2 and activin inhibit XFast-3 expression, ensuring a distinction between those cells responding to Xnr1/2 signalling through XFast-1 and those responding to derrière through XFast-3. These issues will be resolved by analysing the genes whose expression is XFast dependent, and identifying XFast-1- or XFast-3-specific targets.
What is the role of maternal XFast-1? XFast-1 binds DNA in the absence of activated Smads and interacts with activated Smads relatively weakly. By contrast, XFast-3, which appears later, does not efficiently bind DNA alone, but instead forms a very strong complex with activated Smads through its high affinity SIM. We speculate that the binding of maternal XFast-1 to DNA in the absence of activated Smads may be functionally significant in vivo. It may act with co-repressors to keep genes repressed in the absence of ligand, analagous to the Hedgehog, Wnt and Notch signal transduction pathways. Upon ligand induction XFast-1 would be converted to an activator by binding the activated Smads and/or by being replaced by the XFast-3/Smad complex, ARF2.
The phenotype of ARF1 and ARF2 knockdown embryos; comparisons with mice and zebrafish
We have demonstrated that stage 36 embryos depleted of ARF1 and/or ARF2 exhibit a range of phenotypes, which include shortened body axes, disrupted dorsal axial structures, anterior truncations (although the cement gland is still present), reduced dorsal fin and melanophores. The reduced axis length is explicable by our demonstration of reduced convergent extension movements during gastrulation in the ARF-depleted embryos, and we are currently investigating whether the reduced dorsal fin and melanophores are a secondary defect perhaps as a result of inhibition of some aspect of neural crest cell development.
The phenotype of mice deficient in the single known mouse Fast (FoxH1) has been reported (Hoodless et al., 2001
; Yamamoto et al., 2001
) and shows a number of similarities to those described above for Xenopus ARF-depleted embryos. The FoxH1/ embryos can be classified into three phenotypes: type I embryos have axial defects and lack a definitive node and notochord; type II embryos lack anterior structures (such as the head fold), but possess posterior structures with midline defects; and type III embryos lack structures derived from the embryo proper as a result of defects in anteroposterior patterning. Details of these phenotypes suggest a role for Fast/FoxH1 in gastrulation movements in mice and led Yamamoto and colleagues to conclude that loss of Fast-1/FoxH1 in mouse embryos affected Nodal-dependent anteroposterior patterning, and elongation and patterning of the primitive streak, though not Nodal-dependent mesoderm induction (Yamamoto et al., 2001
).
A zebrafish Fast family member has also been cloned and mutant embryos [schmalspur (sur)] that lack functional maternal and zygotic Fast-1 have been characterised (Pogoda et al., 2000
; Sirotkin et al., 2000
). The MZsur embryos display defects in dorsal axial structures, shortened body axis, anterior truncations of the brain, but form endoderm and paraxial mesoderm normally (Pogoda et al., 2000
; Sirotkin et al., 2000
), a phenotype similar to the type I FoxH1/ mouse embryos (Yamamoto et al., 2001
), and reminiscent of the ARF-depleted Xenopus embryos. However, to what extent the sur mutant phenotype results from impairment of gastrulation movements remains to be determined.
Previous work has investigated the function of XFast-1 in Xenopus embryos by overexpression of a dominant-negative engrailed repressor-XFast-1 fusion (FAST-EnR) (Watanabe and Whitman, 1999
). These studies identified many of the phenotypic effects we have described using our morpholino approach such as delayed blastopore closure and later axial defects. However, Watanabe and Whitman also concluded that in Xenopus, Fast-1 was essential for the expression of many mesoendodermal genes (Watanabe and Whitman, 1999
), whereas we found only modest effects with the morpholino approach. This apparent contradiction is easily reconciled. Overexpressed FAST-EnR will bind any promoter with a Fast-binding site and will actively repress that gene, even if the XFast normally only contributes partially to its transcriptional activation. By contrast, when levels of XFasts are knocked down, large effects will only be observed on target genes for which ARF complexes are the predominant activators. Thus, genes activated by ARFs in combination with other transcriptional activators will be completely repressed by the dominant-negative approach, but not necessarily by the knockdown approach. A dramatic demonstration of the different outcomes of these two approaches is seen by comparing the phenotype of the zebrafish Fast-1 null mutant, with the much more severe phenotype of zebrafish embryos overexpressing dominant negative Fast-1 (Stemple, 2000
).
XFast-1 and XFast-3 in nodal/derrière signalling
The phenotypes observed in the mouse and zebrafish resulting from the loss of Fast-1, and now in Xenopus resulting from the knockdown of XFast-1 and XFast-3 levels, are reminiscent of the phenotypes observed in embryos in which nodal signalling is lost, but are much less severe (Whitman, 2001
). This suggests that the Fasts are not the only transcription factors capable of recruiting active Smad complexes to target promoters in response to nodal/derrière signalling. Other transcription factors known to play this role are the Xenopus homeodomain proteins Mixer, Milk and Bix3 and the Mixer orthologue in zebrafish, bonnie and clyde (Germain et al., 2000
; Randall et al., 2002
); there are also likely to be others (Howell and Hill, 1997
).
The major role of ARF1 and ARF2 in Xenopus is in regulating gastrulation movements
Our data suggest a major role for XFast-1/ARF1 and XFast-3/ARF2 in re-programming cell polarity and cell-cell interactions necessary for the convergent extension movements of gastrulation in response to activin-related signals. Indeed XFast-1 and XFast-3 are spatially and temporally well placed to perform this role. At least some of the targets of ARF1 and ARF2 are therefore likely to be genes required for changing cell polarity and adhesion.
In addition to the activin-related signalling pathway, two other signalling pathways have been implicated in gastrulation movements in the Xenopus embryo. These are a non-canonical Wnt pathway activated by XWnt11 (Djiane et al., 2000
; Heisenberg et al., 2000
; Sokol, 1996
; Tada and Smith, 2000
; Wallingford et al., 2000
), and an FGF-dependent signal transduction pathway that is sensitive to XSprouty2 (Nutt et al., 2001
). In both cases, inhibiting these pathways has only limited effects on mesoendodermal gene induction, but greatly inhibits activin-induced elongation of animal caps, indicating that signalling through these pathways is required for activin-mediated gastrulation movements (Nutt et al., 2001
; Tada and Smith, 2000
). These pathways may act sequentially, although we have demonstrated that XWnt11 is not itself a target gene for ARF1 or ARF2, as its expression is unaffected in ARF-depleted embryos. Alternatively, there could be a parallel pathway activated by activin-related ligands, requiring ARF1 and ARF2, that is essential for mediating the convergent extension movements of gastrulation, which synergises with Wnt- and FGF-dependent pathways. Given the involvement of multiple signalling pathways in regulating gastrulation movements, we cannot predict whether the phentotype of ARF-depleted embryos results from large changes in a few key ARF target genes, or small changes in a large number of ARF target genes whose promoters integrate signals from multiple pathways. We are currently screening for ARF target genes to resolve this important issue.
| ACKNOWLEDGMENTS |
|---|
| REFERENCES |
|---|
|
|
|---|
Attisano, L., Silvestri, C., Izzi, L. and Labbe, E. (2001). The transcriptional role of Smads and FAST (FoxH1) in TGFß and activin signalling. Mol. Cell. Endocrinol. 180, 3-11.[Medline]
Beddington, R. S. and Robertson, E. J. (1999). Axis development and early asymmetry in mammals. Cell 96, 195-209.[Medline]
Chen, X., Rubock, M. J. and Whitman, M. (1996). A transcriptional partner for MAD proteins in TGF-ß signalling. Nature 383, 691-696.[Medline]
Chen, X., Weisberg, E., Fridmacher, V., Watanabe, M., Naco, G. and Whitman, M. (1997). Smad4 and FAST-1 in the assembly of activin-responsive factor. Nature 389, 85-89.[Medline]
Dirksen, M. L. and Jamrich, M. (1992). A novel, activin-inducible, blastopore lip-specific gene of Xenopus laevis contains a fork head DNA-binding domain. Genes Dev. 6, 599-608.
Djiane, A., Riou, J., Umbhauer, M., Boucaut, J. and Shi, D. (2000). Role of frizzled 7 in the regulation of convergent extension movements during gastrulation in Xenopus laevis. Development 127, 3091-3100.[Abstract]
Ekker, S. C., McGrew, L. L., Lai, C. J., Lee, J. J., von Kessler, D. P., Moon, R. T. and Beachy, P. A. (1995). Distinct expression and shared activities of members of the hedgehog gene family of Xenopus laevis. Development 121, 2337-2347.[Abstract]
Faure, S., Lee, M. A., Keller, T., ten Dijke, P. and Whitman, M. (2000). Endogenous patterns of TGFß superfamily signaling during early Xenopus development. Development 127, 2917-2931.[Abstract]
Feldman, B., Gates, M. A., Egan, E. S., Dougan, S. T., Rennebeck, G., Sirotkin, H. I., Schier, A. F. and Talbot, W. S. (1998). Zebrafish organizer development and germ-layer formation require nodal-related signals. Nature 395, 181-185.[Medline]
Germain, S., Howell, M., Esslemont, G. M. and Hill, C. S. (2000). Homeodomain and winged-helix transcription factors recruit activated Smads to distinct promoter elements via a common Smad interaction motif. Genes Dev. 14, 435-451.
Heasman, J., Kofron, M. and Wylie, C. (2000). ß-catenin signaling activity dissected in the early Xenopus embryo: a novel antisense approach. Dev. Biol. 222, 124-134.[Medline]
Heisenberg, C. P., Tada, M., Rauch, G. J., Saude, L., Concha, M. L., Geisler, R., Stemple, D. L., Smith, J. C. and Wilson, S. W. (2000). Silberblick/Wnt11 mediates convergent extension movements during zebrafish gastrulation. Nature 405, 76-81.[Medline]
Henrique, D., Adam, J., Myat, A., Chitnis, A., Lewis, J. and Ish-Horowicz, D. (1995). Expression of a Delta homologue in prospective neurons in the chick. Nature 375, 787-790.[Medline]
Hill, C. S. (2001). TGF-ß signalling in early Xenopus development. Curr. Opin. Genet. Dev 11, 533-540.[Medline]
Hoodless, P. A., Pye, M., Chazaud, C., Labbe, E., Attisano, L., Rossant, J. and Wrana, J. L. (2001). FoxH1 (Fast) functions to specify the anterior primitive streak in the mouse. Genes Dev. 15, 1257-1271.
Howe, J. A., Howell, M., Hunt, T. and Newport, J. W. (1995). Identification of a developmental timer regulating the stability of embryonic cyclin A and a new somatic A-type cyclin at gastrulation. Genes Dev. 9, 1164-1176.
Howell, M. and Hill, C. S. (1997). XSmad2 directly activates the activin-inducible, dorsal mesoderm gene XFKH1 in Xenopus embryos. EMBO J. 16, 7411-7421.[Medline]
Howell, M., Itoh, F., Pierreux, C. E., Valgeirsdottir, S., Itoh, S., ten Dijke, P. and Hill, C. S. (1999). Xenopus Smad4ß is the co-Smad component of developmentally-regulated transcription factor complexes responsible for induction of early mesodermal genes. Dev. Biol. 214, 354-369.[Medline]
Howell, M., Mohun, T. J. and Hill, C. S. (2001). Xenopus Smad3 is specifically expressed in the chordoneural hinge, notochord and in the endocardium of the developing heart. Mech. Dev. 104, 147-150.[Medline]
Jones, C. M., Kuehn, M. R., Hogan, B. L. M., Smith, J. C. and Wright, C. V. E. (1995). Nodal-related signals induce axial mesoderm and dorsalize mesoderm during gastrulation. Development 121, 3651-3662.[Abstract]
Kaufmann, E. and Knöchel, W. (1996). Five years on the wings of forkhead. Mech. Dev. 57, 3-20.[Medline]
Keller, R. (1991). Early embryonic development of Xenopus laevis. Methods Cell Biol 36, 61-113.[Medline]
Kim, S. H., Yamamoto, A., Bouwmeester, T., Agius, E. and De Robertis, E. M. (1998). The role of paraxial protocadherin in selective adhesion and cell movements of the mesoderm during Xenopus gastrulation. Development 125, 4681-4690.[Abstract]
Lee, M. A., Heasman, J. and Whitman, M. (2001). Timing of endogenous activin-like signals and regional specification of the Xenopus embryo. Development 128, 2939-2952.
Nasevicius, A. and Ekker, S. C. (2000). Effective targeted gene knockdown in zebrafish. Nat. Genet. 26, 216-220.[Medline]
Nieuwkoop, P. D. (1969). The formation of mesoderm in Urodelean amphibians. I. Induction by the endoderm. Wilhelm Rouxs Arch. EntwMech. Org. 162, 341-373.
Nutt, S. L., Dingwell, K. S., Holt, C. E. and Amaya, E. (2001). Xenopus Sprouty2 inhibits FGF-mediated gastrulation movements but does not affect mesoderm induction and patterning. Genes Dev. 15, 1152-1166.
Osada, S., Saijoh, Y., Frisch, A., Yeo, C., Adachi, H., Watanabe, M., Whitman, M., Hamada, H. and Wright, C. V. (2000). Activin/Nodal responsiveness and asymmetric expression of a Xenopus nodal-related gene converge on a FAST-regulated module in intron 1. Development 127, 2503-2514.[Abstract]
Pierreux, C. E., Nicolás, F. J. and Hill, C. S. (2000). Transforming growth factor ß-independent shuttling of Smad4 between the cytoplasm and nucleus. Mol. Cell. Biol. 20, 9041-9054.
Pogoda, H., Solnica-Krezel, L., Driever, W. and Meyer, D. (2000). The zebrafish forkhead transcription factor FoxH1/Fast1 is a modulator of nodal signaling required for organizer formation. Curr. Biol. 10, 1041-1049.[Medline]
Randall, R. A., Germain, S., Inman, G. J., Bates, P. A. and Hill, C. S. (2002). Different Smad2 partners bind a common hydrophobic pocket in Smad2 via a defined proline-rich motif. EMBO J. 21, 145-156.[Medline]
Ruiz i Altaba, A. and Jessell, T. M. (1992). Pintallavis, a gene expressed in the organizer and midline cells of frog embryos: involvement in the development of the neural axis. Development 116, 81-93.[Abstract]
Schier, A. F. and Shen, M. M. (2000). Nodal signalling in vertebrate development. Nature 403, 385-389.[Medline]
Sirotkin, H. I., Gates, M. A., Kelly, P. D., Schier, A. F. and Talbot, W. S. (2000). fast1 is required for the development of dorsal axial structures in zebrafish. Curr. Biol. 10, 1051-1054.[Medline]
Smith, J. C. (1995). Mesoderm-inducing factors and mesodermal patterning. Curr. Opin. Cell Biol. 7, 856-861.[Medline]
Smith, J. C., Price, B. M., Green, J. B., Weigel, D. and Herrmann, B. G. (1991). Expression of a Xenopus homolog of Brachyury (T) is an immediate-early response to mesoderm induction. Cell 67, 79-87.[Medline]
Sokol, S. Y. (1996). Analysis of Dishevelled signalling pathways during Xenopus development. Curr. Biol. 6, 1456-1467.[Medline]
Stemple, D. L. (2000). Vertebrate development: The fast track to Nodal signalling. Curr. Biol. 10, R843-R846.[Medline]
Summerton, J. and Weller, D. (1997). Morpholino antisense oligomers: design, preparation, and properties. Antisense Nucleic Acid Drug Dev 7, 187-195.[Medline]
Sun, B. I., Bush, S. M., Collins-Racie, L. A., LaVallie, E. R., DiBlasio-Smith, E. A., Wolfman, N. M., McCoy, J. M. and Sive, H. L. (1999). derrière: a TGF-ß family member required for posterior development in Xenopus. Development 126, 1467-1482.[Abstract]
Tada, M. and Smith, J. C. (2000). Xwnt11 is a target of Xenopus Brachyury: regulation of gastrulation movements via Dishevelled, but not through the canonical Wnt pathway. Development 127, 2227-2238.[Abstract]
Wallingford, J. B., Rowning, B. A., Vogeli, K. M., Rothbacher, U., Fraser, S. E. and Harland, R. M. (2000). Dishevelled controls cell polarity during Xenopus gastrulation. Nature 405, 81-85.[Medline]
Watanabe, M. and Whitman, M. (1999). FAST-1 is a key maternal effector of mesoderm inducers in the early Xenopus embryo. Development 126, 5621-5634.[Abstract]
Whitman, M. (2001). Nodal signaling in early vertebrate embryos. Themes and variations. Dev. Cell 1, 605-617.[Medline]
Winklbauer, R., Medina, A., Swain, R. K. and Steinbeisser, H. (2001). Frizzled-7 signalling controls tissue separation during Xenopus gastrulation. Nature 413, 856-860.[Medline]
Yamamoto, M., Meno, C., Sakai, Y., Shiratori, H., Mochida, K., Ikawa, Y., Saijoh, Y. and Hamada, H. (2001). The transcription factor FoxH1 (FAST) mediates Nodal signaling during anterior-posterior patterning and node formation in the mouse. Genes Dev. 15, 1242-1256.
Zhang, J., Houston, D. W., King, M. L., Payne, C., Wylie, C. and Heasman, J. (1998). The role of maternal VegT in establishing the primary germ layers in Xenopus embryos. Cell 94, 515-524.[Medline]
| ||||||||||||||||||||||||||||||||||||||||||||||||||