|
|
|
|||
| Home Help Feedback Subscriptions Archive Search Table of Contents | ||||
1 Universität Zürich, Zoologisches Institut, Winterthurerstrasse 190, CH 8057, Zürich, Switzerland
2 Université de Fribourg, Institute de Biochemie, Rue du Musée 5, CH 1700, Fribourg, Switzerland
*Author for correspondence (e-mail: hafen{at}zool.unizh.ch)
Accepted 10 June 2002
| SUMMARY |
|---|
|
|
|---|
Key words: Growth, PtdInsP3, Pten, Cancer, Tumor suppressor, Insulin, PI 3 kinase
| INTRODUCTION |
|---|
|
|
|---|
The IR and IGFR act through IRS1-IRS4 proteins, which are multifunctional adaptors that link insulin and IGF signaling to the Ras/MAPK and phosphoinositide 3'-kinase (PI 3-kinase) signaling pathways (Yenush and White, 1997
). The pleckstrin homology domain (PH) and phosphotyrosine binding domain (PTB) of the IRS proteins are believed to mediate binding to phosphoinositol phosphates and the juxtamembrane NPXY motif of IR/IGFR, respectively (Yenush et al., 1997
). Drk is the Drosophila homolog of Grb2, an adaptor protein containing SH2 and SH3 domains. It has been suggested that Grb2 may, via its binding to IRS (Olivier et al., 1993
), link insulin/IGF to the Ras/MAPK pathway and thereby control proliferation (Simon et al., 1993
; Skolnik et al., 1993
; Yenush et al., 1997
). The Drosophila homolog of the SH2 domain containing p85 PI 3-kinase adaptor subunit, p60, binds Chico/IRS and thereby recruits the p110 catalytic subunit of PI 3-kinase [which converts phosphoinositol(4,5)P2 (PtdIns(4,5)P2) into phosphoinositol(3,4,5)P3 (PtdIns(3,4,5)P3)] to the plasma membrane (Leevers et al., 1996
; Yenush et al., 1997
; Stambolic et al., 1998
; Maehama and Dixon, 1999
; Weinkove et al., 1999
). The p110 PI 3-kinase belongs to the class I PI 3-kinases implicated in the metabolic effects of insulin (Vanhaesebroeck et al., 2001
). The classical effectors that mediate the biological outcomes of insulin and IGF downstream of IRS have been divided into two functional branches: the Ras/MAPK proliferation pathway, and the PI 3-kinase metabolic, growth and survival pathway (Yenush et al., 1997
; Vanhaesebroeck et al., 2001
).
Hyperactivation of IGF signaling pathways is associated with a wide variety of tumors (Valentinis and Baserga, 2001
). Components in each of these pathways have been implicated in the initiation and progression of a wide variety of human malignancies. Because both branches are strongly implicated in contributing to tumorigenesis, it is important to determine the relative contribution of each pathway to the processes of growth and proliferation, and thus tumorigenesis. We used two types of approaches to address the relative contribution of the two major effector branches to the processes of growth, proliferation and organismal size control during development. In the first, we analyzed the effects of amino acid substitutions in the different effector sites of the Chico protein. In the second approach, we analyzed the effects of modulating the activity of the PI 3-kinase pathway by genetically altering the levels of PtdInsP3 within the cells. The results obtained from both experimental strategies provide strong evidence that in Drosophila, the PI 3-kinase branch is necessary and sufficient to control InR-mediated growth and proliferation. Furthermore, the results suggest a pivotal role of cellular PtdInsP3 levels in the control of cell growth.
| MATERIALS AND METHODS |
|---|
|
|
|---|
Mutant analysis
Pten2L100 is a viable hypomorphic mutation located outside of the ORF. Pten2L117 is a strong mutation (5 basepair deletion causing a frameshift at amino acid position 165 resulting in the insertion of 35 new codons (AYKGPKRCDNPISASICSVFFQTSLFKCSIFESKP) before the new stop codon located in the catalytic domain) and behaves similar to a null mutation. These mutations fail to complement other previously identified mutations of Pten and the lethality is rescued by a Pten genomic rescue construct, which identifies them as alleles of Pten. Pten2L100 is a weak temperature-sensitive mutation. Heteroallelic mutants are pupal lethal, but when shifted from 25°C to 18°C during wandering 3rd instar stage allow for viable heteroallelic escapers. Slightly rough eyes, concave wings, and over-enlarged legs are occasionally observed. However, no signs of Ras pathway hyperactivation were observed, such as multiple photoreceptors or extra wing veins. The weighing and metabolic assays were performed according to the methods of Böhni et al. (Böhni et al., 1999
), except that Pten heteroallelic mutant flies were raised at 18°C.
Fertility and starvation assays
All analyses were performed in a y w background. The fertility assay was performed by mating 15 males and females of the genotype y w; chico1/chico1; P{w+ chicoPH1.1 or chicoPTB7.2 or chicoDrk2.1 or chicoPI3K9 or chicowt4.2 Rescue Construct}/+ and after 1 day of egg laying, the number of pupae was determined. The starvation assay was performed by taking 10-15 freshly eclosed females of the indicated genotypes and placing them in a container with a water-soaked cotton plug. The number of viable flies was determined at each time point.
Metabolic labeling
Briefly, 3rd instar non-wandering larvae were phosphate starved in phosphate-free Schneider S2 medium and then labeled with 2 mCi/sample inorganic 32P (50 mCi/ml; NEN Life Science Products). PtdInsP3 and PtdInsP2 levels were determined as described previously (Arcaro and Wymann, 1993
).
| RESULTS |
|---|
|
|
|---|
|
To test whether increasing PtdInsP3 levels in an InR or PI 3-kinase p110 mutant background is sufficient to restore growth, we eliminated the function of a negative regulator of the insulin pathway. The 3'-phosphoinositol-specific lipid phosphatase, PTEN acts as a negative regulator of the PI 3-kinase pathway by converting PtdInsP3 generated by PI 3-kinase into PtdInsP2 (Stambolic et al., 1998
; Maehama et al., 1999
). We utilized a null (Pten2L117) and a hypomorphic (Pten2L100) allele of Pten which were identified in a screen for genes involved in growth control (Oldham et al., 2000b
). As shown by HPLC analysis of the phospholipids in extracts of Pten mutant larvae, the loss of PTEN function results in a 2-fold increase in PtdInsP3 levels (Fig. 2A). This is consistent with the increase in PtdInsP3 seen in Pten-deleted murine fibroblasts (Stambolic et al., 1998
). One prominent biological effect of these increased PtdInsP3 levels in Drosophila is a substantial increase in size in both larvae and pupae (Fig. 2B). To test whether loss of PTEN function, and consequently increased PtdInsP3 levels, is sufficient to restore growth or viability in InR null mutants, we first generated InR and Pten double mutants by creating mosaic animals using the eyeless-Flipase (eyFlp) tissue-specific recombination system (Newsome et al., 2000
). In such animals, the head consists of homozygous mutant tissue, whereas the rest of the body is heterozygous for the same mutation. While loss of PTEN function (Pten2L117) in the head results in a fly with a disproportionately larger head (with more and larger cells), loss of InR function (InR327) results in flies with smaller heads (pinhead) compared to the wild type (Fig. 2C,D,E, Fig. 3A). Heads doubly mutant for Pten2L117and InR327, however, are almost the size of heads singly mutant for Pten2L117 (Fig. 2F, Fig. 3A). Secondly, two different lethal heteroallelic InR combinations (InR304/InR327 or InR304/InR25) (Fernandez et al., 1995
; Chen et al., 1996
), which arrest at the 2nd larval instar stage, develop to the pupal stage (15-17% of 33% expected) and even to pharate adults in the presence of reduced PTEN levels (Pten2L117/Pten2L100) (Fig. 2G,H). These results demonstrate that complete loss of PTEN function can largely substitute for InR-mediated growth and proliferation in the absence of InR function and that the Ras/MAPK pathway plays little or no role in the InR mediated control of cell growth. This notion is further supported by the observation that complete loss of InR function in the compound eye does not result in a loss of photoreceptors, a hallmark of loss of Ras pathway function (Brogiolo et al., 2001
).
|
|
Because loss of Chico function results in increased lipid levels as well as a dramatic decrease in body size (Böhni et al., 1999
), we determined whether PTEN might also have a function in metabolic and body size control like Chico. As seen in Fig. 4A,B, partial loss of PTEN function results in flies that are considerably bigger than controls. They weigh approximately 50 percent more than their heterozygous siblings without showing any apparent effect on cell differentiation. The increase in size is due to an increase in both cell size and number as determined by a morphometric analysis of the wing and eye (data not shown). When the levels of lipids and glycogen were measured, a decrease per mass in lipid and glycogen was observed compared to Pten mutant flies rescued by a genomic Pten transgene (Fig. 4C). One biological outcome of this difference is a twofold increase in the rate of mortality under water-only starvation conditions compared to a 2-fold decrease in chico mutant flies (Fig. 4D). Thus lipid and glycogen levels strongly correlate with the survival time under starvation conditions. Since Chico and PTEN activity regulates growth during development and the accumulation of energy stores in the adult, the effects of InR-mediated growth and lipid/glycogen metabolism must diverge downstream of Pten.
|
| DISCUSSION |
|---|
|
|
|---|
Viable allelic combinations of insulin receptor pathway components result in at least three characteristic phenotypes: small body size, female sterility and increased lipid content (Chen et al., 1996
; Böhni et al., 1999
). The results from the chico effector mutants permit the separation of the three different Chico phenotypes.
(1) Size and fertility. Is there a causal link between the small body size and female sterility? The PTB domain mutant rescues the sterility, but not the size defect, thus separating the growth and the sterility phenotypes. It remains to be resolved whether different levels of PI 3-kinase activation are needed to restore growth and fertility or whether control of fertility involves at least in part the association of Chico with a different receptor which does not require the PTB domain. For the growth regulatory function of Chico, a functional PTB and PH domain are essential. This indicates that in vivo, in the absence of overexpression, these two domains serve non-redundant functions presumably in the localization to the membrane and binding to the insulin/IGF receptor.
(2) Size and lipids. Does the small size cause the increased lipid levels? Chico mutant flies lacking functional p60/PI 3-kinase binding sites, PTB or PH domains are all small, yet the increase in lipid levels is less pronounced than in chico null mutant flies. Also, the Irs2-deleted mice and insulin pathway mutants in C. elegans are not small, yet display increased lipids (Kimura et al., 1997
; Burks et al., 2000
). Therefore, there seems to be no direct correlation between developmental growth and energy stores in the adult.
(3) Lipids and sterility. Like chico flies, mice mutant for IRS2 or lacking insulin receptor function in the brain (NIRKO) display increased lipids and are female sterile. Are the increased lipid levels a sign of metabolic dysfunction that leads to the female sterility? The chico PI 3-kinase, PTB and PH effector mutants have similar lipid increases, yet the PTB mutant is fertile while the PI 3-kinase mutant is not. Therefore, there appears to be no direct correlation between lipid accumulation and sterility in Drosophila.
The rescue of lethal, null InR mutant combinations to near viability by reducing PTEN activity strengthens the argument that a PtdInsP3-dependent signaling pathway is the primary effector for InR-derived growth and proliferation. In support of this observation, PI 3-kinase and Akt have been isolated as retroviral oncogenes, suggesting that activation of PI 3-kinase and Akt is sufficient to mediate growth, proliferation, and oncogenesis in vertebrate systems (Bellacosa et al., 1991
; Chang et al., 1997
). In Drosophila and mammals, overexpression of PI 3-kinase causes increased growth; but this is not sufficient for proliferation as is removal of Pten (Klippel et al., 1998
; Goberdhan et al., 1999
; Huang et al., 1999
; Weinkove et al., 1999
; Gao et al., 2000
). From this premise, it has been proposed that PI 3-kinase and PTEN regulate similar yet distinct pathways (Gao et al., 2000
). Alternatively, it is possible that they do function uniquely in the same pathway and that the difference may be due to altered location and function because of overexpression, or to differential feedback of PI 3-kinase versus PTEN. For example, as PI 3-kinase has been shown to act as a serine/threonine protein kinase on IRS, this may have a negative feedback effect on the insulin pathway that might not be evident in Pten loss-of-function mutations (Pirola et al., 2001
). Nevertheless, PI 3-kinase is absolutely critical in controlling size because using an allelic series of PI 3-kinase mutants in combination with the ey-Flp sytem resulted in a range of different head sizes (data not shown). Furthermore, expressing an activated and dominant-negative form of PI 3-kinase in Drosophila imaginal discs or the heart of the mouse also leads to a corresponding increase or decrease in cell and organ size (Weinkove et al., 1999
; Shioi et al., 2000
). Thus, the PI 3-kinase/PTEN cycle can be considered a dedicated growth rheostat, and the InR pathway is an evolutionary conserved module for regulating the range of growth and size.
Loss of PTEN function results in a metabolically similar phenotype to loss of murine PTP1B (Ptpn1), an IR-specific tyrosine phosphatase, in that hyperactivation of the IR pathway causes resistance to high-fat-diet-induced obesity because of increased basal metabolism (Elchebly et al., 1999
; Klaman et al., 2000
). These metabolic lipid effects have likely been conserved during evolution because the increased lipid levels in chico mutants are reminiscent of the enhanced lipid content in Irs2 deleted and NIRKO mice (Bruning et al., 2000
; Burks et al., 2000
).
Collectively, these data firmly establish Drosophila as a valid model organism for the study of metabolic diseases like diabetes and obesity as well as for the study of growth disorders like cancer. Pten mutant flies are larger in size due to increased cell size and number, but have a corresponding decrease in energy stores, a situation completely opposite to mutations in positive components of the insulin signaling pathway like InR, chico, PI 3-kinase, and dAkt. These large viable Pten mutants show that a reduction of PTEN function is sufficient for increased organism size. This fact suggests that the four-fold size difference between viable InR and Pten mutants can simply be controlled by the amount of PtdInsP3 and this phenomenon may possibly be extended to vertebrate size regulation. Thus, in Drosophila, the InR/PI 3-kinase/PTEN pathway combines both metabolism and growth control into one pathway that later diverged into two separate, yet interacting systems in mammals.
| ACKNOWLEDGMENTS |
|---|
| REFERENCES |
|---|
|
|
|---|
Araki, E., Lipes, M. A., Patti, M. E., Bruning, J. C., Haag, B., 3rd, Johnson, R. S. and Kahn, C. R. (1994). Alternative pathway of insulin signalling in mice with targeted disruption of the IRS-1 gene. Nature 372, 186-190.[Medline]
Arcaro, A. and Wymann, M. P. (1993). Wortmannin is a potent phosphatidylinositol 3-kinase inhibitor: the role of phosphatidylinositol 3,4,5-trisphosphate in neutrophil responses. Biochem. J. 296, 297-301.
Bellacosa, A., Testa, J. R., Staal, S. P. and Tsichlis, P. N. (1991). A retroviral oncogene, akt, encoding a serine-threonine kinase containing an SH2-like region. Science 254, 274-277.
Böhni, R., Riesgo-Escovar, J., Oldham, S., Brogiolo, W., Stocker, H., Andruss, B. F., Beckingham, K. and Hafen, E. (1999). Autonomous control of cell and organ size by CHICO, a Drosophila homolog of vertebrate IRS1-4. Cell 97, 865-875.[Medline]
Brogiolo, W., Stocker, H., Ikeya, T., Rintelen, F., Fernandez, R. and Hafen, E. (2001). An evolutionarily conserved function of the Drosophila insulin receptor and insulin-like peptides in growth control. Curr. Biol. 11, 213-221.[Medline]
Bruning, J. C., Gautam, D., Burks, D. J., Gillette, J., Schubert, M., Orban, P. C., Klein, R., Krone, W., Muller-Wieland, D. and Kahn, C. R. (2000). Role of brain insulin receptor in control of body weight and reproduction. Science 289, 2122-2125.
Burks, D. J., de Mora, J. F., Schubert, M., Withers, D. J., Myers, M. G., Towery, H. H., Altamuro, S. L., Flint, C. L. and White, M. F. (2000). IRS-2 pathways integrate female reproduction and energy homeostasis. Nature 407, 377-382.[Medline]
Chang, H. W., Aoki, M., Fruman, D., Auger, K. R., Bellacosa, A., Tsichlis, P. N., Cantley, L. C., Roberts, T. M. and Vogt, P. K. (1997). Transformation of chicken cells by the gene encoding the catalytic subunit of PI 3-kinase. Science 276, 1848-1850.
Chen, C., Jack, J. and Garofalo, R. S. (1996). The Drosophila insulin receptor is required for normal growth. Endocrinology 137, 846-856.[Abstract]
Elchebly, M., Payette, P., Michaliszyn, E., Cromlish, W., Collins, S., Loy, A. L., Normandin, D., Cheng, A., Himms-Hagen, J., Chan, C. C. et al.. (1999). Increased insulin sensitivity and obesity resistance in mice lacking the protein tyrosine phosphatase-1B gene. Science 283, 1544-1548.
Fernandez, R., Tabarini, D., Azpiazu, N., Frasch, M. and Schlessinger, J. (1995). The Drosophila insulin receptor homolog: a gene essential for embryonic development encodes two receptor isoforms with different signaling potential. EMBO J. 14, 3373-3384.[Medline]
Gao, X., Neufeld, T. P. and Pan, D. (2000). Drosophila PTEN regulates cell growth and proliferation through PI3K-dependent and independent pathways. Dev. Biol. 221, 404-418.[Medline]
Garofalo, R. S. (2002). Genetic analysis of insulin signaling in Drosophila. Trends Endocrinol. Metab. 13, 156-162.[Medline]
Goberdhan, D. C., Paricio, N., Goodman, E. C., Mlodzik, M. and Wilson, C. (1999). Drosophila tumor suppressor PTEN controls cell size and number by antagonizing the Chico/PI3-kinase signaling pathway. Genes Dev. 13, 3244-3258.
Huang, H., Potter, C. J., Tao, W., Li, D. M., Brogiolo, W., Hafen, E., Sun, H. and Xu, T. (1999). PTEN affects cell size, cell proliferation and apoptosis during Drosophila eye development. Development 126, 5365-5372.[Abstract]
Kimura, K. D., Tissenbaum, H. A., Liu, Y. and Ruvkun, G. (1997). daf-2, an insulin receptor-like gene that regulates longevity and diapause in Caenorhabditis elegans. Science 277, 942-946.
Klaman, L. D., Boss, O., Peroni, O. D., Kim, J. K., Martino, J. L., Zabolotny, J. M., Moghal, N., Lubkin, M., Kim, Y. B., Sharpe, A. H. et al. (2000). Increased energy expenditure, decreased adiposity, and tissue-specific insulin sensitivity in protein-tyrosine phosphatase 1B-deficient mice. Mol. Cell. Biol. 20, 5479-5489.
Klippel, A., Escobedo, M. A., Wachowicz, M. S., Apell, G., Brown, T. W., Giedlin, M. A., Kavanaugh, W. M. and Williams, L. T. (1998). Activation of phosphatidylinositol 3-kinase is sufficient for cell cycle entry and promotes cellular changes characteristic of oncogenic transformation. Mol. Cell. Biol. 18, 5699-5711.
Leevers, S. J., Weinkove, D., MacDougall, L. K., Hafen, E. and Waterfield, M. D. (1996). The Drosophila phosphoinositide 3-kinase Dp110 promotes cell growth. EMBO J. 15, 6584-6594.[Medline]
Liu, J. P., Baker, J., Perkins, A. S., Robertson, E. J. and Efstratiadis, A. (1993). Mice carrying null mutations of the genes encoding insulin-like growth factor I (Igf-1) and type 1 IGF receptor (Igf1r). Cell 75, 59-72.[Medline]
Maehama, T. and Dixon, J. E. (1999). PTEN: a tumour suppressor that functions as a phospholipid phosphatase. Trends Cell Biol. 9, 125-128.[Medline]
Newsome, T. P., Asling, B. and Dickson, B. J. (2000). Analysis of Drosophila photoreceptor axon guidance in eye-specific mosaics. Development 127, 851-860.[Abstract]
Oldham, S., Böhni, R., Stocker, H., Brogiolo, W. and Hafen, E. (2000a). Genetic control of size in Drosophila. Phil. Trans. R. Soc. Lond. B. 355, 945-952.[Medline]
Oldham, S., Montagne, J., Radimerski, T., Thomas, G. and Hafen, E. (2000b). Genetic and biochemical characterization of dTOR, the Drosophila homolog of the target of rapamycin. Genes Dev. 14, 2689-2694.
Olivier, J. P., Raabe, T., Henkemeyer, M., Dickson, B., Mbamalu, G., Margolis, B., Schlessinger, J., Hafen, E. and Pawson, T. (1993). A Drosophila SH2-SH3 adaptor protein implicated in coupling the sevenless tyrosine kinase to an activator of Ras guanine nucleotide exchange, Sos. Cell 73, 179-191.[Medline]
Pirola, L., Zvelebil, M. J., Bulgarelli-Leva, G., van Obberghen, E., Waterfield, M. D. and Wymann, M. P. (2001). Activation loop sequences confer substrate specificity to phosphoinositide 3-kinase alpha (PI3Kalpha). Functions of lipid kinase-deficient PI3Kalpha in signaling. J. Biol. Chem. 276, 21544-21554.
Shioi, T., Kang, P. M., Douglas, P. S., Hampe, J., Yballe, C. M., Lawitts, J., Cantley, L. C. and Izumo, S. (2000). The conserved phosphoinositide 3-kinase pathway determines heart size in mice. EMBO J. 19, 2537-2548.[Medline]
Simon, M. A., Dodson, G. S. and Rubin, G. M. (1993). An SH3-SH2-SH3 protein is required for p21Ras1 activation and binds to sevenless and Sos proteins in vitro. Cell 73, 169-177.[Medline]
Skolnik, E. Y., Batzer, A., Li, N., Lee, C. H., Lowenstein, E., Mohammadi, M., Margolis, B. and Schlessinger, J. (1993). The function of GRB2 in linking the insulin receptor to Ras signaling pathways. Science 260, 1953-1955.
Stambolic, V., Suzuki, A., de la Pompa, J. L., Brothers, G. M., Mirtsos, C., Sasaki, T., Ruland, J., Penninger, J. M., Siderovski, D. P. and Mak, T. W. (1998). Negative regulation of PKB/Akt-dependent cell survival by the tumor suppressor PTEN. Cell 95, 29-39.[Medline]
Tamemoto, H., Kadowaki, T., Tobe, K., Yagi, T., Sakura, H., Hayakawa, T., Terauchi, Y., Ueki, K., Kaburagi, Y. and Satoh, S. (1994). Insulin resistance and growth retardation in mice lacking insulin receptor substrate-1. Nature 372, 182-186.[Medline]
Valentinis, B. and Baserga, R. (2001). IGF-1 receptor signalling in transformation and differentiation. Mol. Pathol. 54, 133-137.
Vanhaesebroeck, B., Leevers, S. J., Ahmadi, K., Timms, J., Katso, R., Driscoll, P. C., Woscholski, R., Parker, P. J. and Waterfield, M. D. (2001). Synthesis and function of 3-phosphorylated inositol lipids. Annu. Rev. Biochem. 70, 535-602.[Medline]
Verdu, J., Buratovich, M. A., Wilder, E. L. and Birnbaum, M. J. (1999). Cell-autonomous regulation of cell and organ growth in Drosophila by Akt/PKB. Nat. Cell Biol. 1, 500-506.[Medline]
Weinkove, D., Neufeld, T. P., Twardzik, T., Waterfield, M. D. and Leevers, S. J. (1999). Regulation of imaginal disc cell size, cell number and organ size by Drosophila class I(A) phosphoinositide 3-kinase and its adaptor. Curr. Biol. 9, 1019-1029.[Medline]
Yenush, L., Fernandez, R., Myers, M. G., Jr, Grammer, T. C., Sun, X. J., Blenis, J., Pierce, J. H., Schlessinger, J. and White, M. F. (1996). The Drosophila insulin receptor activates multiple signaling pathways but requires insulin receptor substrate proteins for DNA synthesis. Mol. Cell. Biol. 16, 2509-2517.[Abstract]
Yenush, L. and White, M. F. (1997). The IRS-signalling system during insulin and cytokine action. BioEssays 19, 491-500.[Medline]
This article has been cited by other articles:
![]() |
H. McNeill, G. M. Craig, and J. M. Bateman Regulation of Neurogenesis and Epidermal Growth Factor Receptor Signaling by the Insulin Receptor/Target of Rapamycin Pathway in Drosophila Genetics, June 1, 2008; 179(2): 843 - 853. [Abstract] [Full Text] [PDF] |
||||
![]() |
V. Dave, S. E. Wert, T. Tanner, A. R. Thitoff, D. E. Loudy, and J. A. Whitsett Conditional Deletion of Pten Causes Bronchiolar Hyperplasia Am. J. Respir. Cell Mol. Biol., March 1, 2008; 38(3): 337 - 345. [Abstract] [Full Text] [PDF] |
||||
![]() |
S. Sugiyama, S. Moritoh, Y. Furukawa, T. Mizuno, Y.-M. Lim, L. Tsuda, and Y. Nishida Involvement of the Mitochondrial Protein Translocator Component Tim50 in Growth, Cell Proliferation and the Modulation of Respiration in Drosophila Genetics, June 1, 2007; 176(2): 927 - 936. [Abstract] [Full Text] [PDF] |
||||
![]() |
N. Vereshchagina and C. Wilson Cytoplasmic activated protein kinase Akt regulates lipid-droplet accumulation in Drosophila nurse cells Development, December 1, 2006; 133(23): 4731 - 4735. [Abstract] [Full Text] [PDF] |
||||
![]() |
A. Dekanty, S. Lavista-Llanos, M. Irisarri, S. Oldham, and P. Wappner The insulin-PI3K/TOR pathway induces a HIF-dependent transcriptional response in Drosophila by promoting nuclear localization of HIF-{alpha}/Sima J. Cell Sci., December 1, 2005; 118(23): 5431 - 5441. [Abstract] [Full Text] [PDF] |
||||
![]() |
W. von Stein, A. Ramrath, A. Grimm, M. Muller-Borg, and A. Wodarz Direct association of Bazooka/PAR-3 with the lipid phosphatase PTEN reveals a link between the PAR/aPKC complex and phosphoinositide signaling Development, April 1, 2005; 132(7): 1675 - 1686. [Abstract] [Full Text] [PDF] |
||||
![]() |
R. M. Easton, H. Cho, K. Roovers, D. W. Shineman, M. Mizrahi, M. S. Forman, V. M.-Y. Lee, M. Szabolcs, R. de Jong, T. Oltersdorf, et al. Role for Akt3/Protein Kinase B{gamma} in Attainment of Normal Brain Size Mol. Cell. Biol., March 1, 2005; 25(5): 1869 - 1878. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. H. Reiling and E. Hafen The hypoxia-induced paralogs Scylla and Charybdis inhibit growth by down-regulating S6K activity upstream of TSC in Drosophila Genes & Dev., December 1, 2004; 18(23): 2879 - 2892. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. Papadopoulou, M. W. Bianchi, and M. Bourouis Functional Studies of Shaggy/Glycogen Synthase Kinase 3 Phosphorylation Sites in Drosophila melanogaster Mol. Cell. Biol., June 1, 2004; 24(11): 4909 - 4919. [Abstract] [Full Text] [PDF] |
||||
![]() |
J. K. Inlow and L. L. Restifo Molecular and Comparative Genetics of Mental Retardation Genetics, February 1, 2004; 166(2): 835 - 881. [Abstract] [Full Text] [PDF] |
||||
![]() |
M. Miron, P. Lasko, and N. Sonenberg Signaling from Akt to FRAP/TOR Targets both 4E-BP and S6K in Drosophila melanogaster Mol. Cell. Biol., December 15, 2003; 23(24): 9117 - 9126. [Abstract] [Full Text] [PDF] |
||||
![]() |
D. C.I. Goberdhan and C. Wilson PTEN: tumour suppressor, multifunctional growth regulator and more Hum. Mol. Genet., October 15, 2003; 12(90002): R239 - 248. [Abstract] [Full Text] [PDF] |
||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||